Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1115443..1116063 | Replicon | chromosome |
| Accession | NZ_CP110857 | ||
| Organism | Enterobacter hormaechei strain K432 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | OQO37_RS05325 | Protein ID | WP_015571250.1 |
| Coordinates | 1115443..1115661 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | OQO37_RS05330 | Protein ID | WP_006809850.1 |
| Coordinates | 1115689..1116063 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQO37_RS05295 (OQO37_05295) | 1111455..1111715 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| OQO37_RS05300 (OQO37_05300) | 1111718..1111858 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| OQO37_RS05305 (OQO37_05305) | 1111855..1112565 | - | 711 | WP_023303201.1 | GNAT family protein | - |
| OQO37_RS05310 (OQO37_05310) | 1112667..1114127 | + | 1461 | WP_032620143.1 | PLP-dependent aminotransferase family protein | - |
| OQO37_RS05315 (OQO37_05315) | 1114099..1114566 | - | 468 | WP_017383209.1 | YlaC family protein | - |
| OQO37_RS05320 (OQO37_05320) | 1114683..1115234 | - | 552 | WP_023303203.1 | maltose O-acetyltransferase | - |
| OQO37_RS05325 (OQO37_05325) | 1115443..1115661 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| OQO37_RS05330 (OQO37_05330) | 1115689..1116063 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| OQO37_RS05335 (OQO37_05335) | 1116574..1119720 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OQO37_RS05340 (OQO37_05340) | 1119743..1120936 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T264376 WP_015571250.1 NZ_CP110857:c1115661-1115443 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT264376 WP_006809850.1 NZ_CP110857:c1116063-1115689 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |