Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipB(antitoxin) |
Location | 3972579..3973029 | Replicon | chromosome |
Accession | NZ_CP110791 | ||
Organism | Yersinia sp. SCPM-O-B-9106 (C-191) |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | OP863_RS17955 | Protein ID | WP_261369802.1 |
Coordinates | 3972895..3973029 (+) | Length | 45 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | OP863_RS17950 | Protein ID | WP_186368366.1 |
Coordinates | 3972579..3972893 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP863_RS17935 (OP863_17935) | 3967997..3969646 | - | 1650 | WP_038638574.1 | Na+/H+ antiporter | - |
OP863_RS17940 (OP863_17940) | 3969859..3971226 | - | 1368 | WP_038638571.1 | NCS2 family permease | - |
OP863_RS17945 (OP863_17945) | 3971645..3972316 | - | 672 | WP_145588503.1 | glutathione S-transferase | - |
OP863_RS17950 (OP863_17950) | 3972579..3972893 | + | 315 | WP_186368366.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OP863_RS17955 (OP863_17955) | 3972895..3973029 | + | 135 | WP_261369802.1 | hypothetical protein | Toxin |
OP863_RS17960 (OP863_17960) | 3973132..3973449 | + | 318 | WP_265525678.1 | hypothetical protein | - |
OP863_RS17965 (OP863_17965) | 3973514..3974062 | - | 549 | WP_145588509.1 | single-stranded DNA-binding protein | - |
OP863_RS17970 (OP863_17970) | 3974475..3977306 | + | 2832 | WP_038638557.1 | excinuclease ABC subunit UvrA | - |
OP863_RS17975 (OP863_17975) | 3977366..3977719 | - | 354 | WP_038638554.1 | MmcQ/YjbR family DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 5368.06 Da Isoelectric Point: 10.4251
>T264265 WP_261369802.1 NZ_CP110791:3972895-3973029 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MTRRTQRLNIWMNGQRVGYWEKKRGEESLSYAQEWLANEQGRPL
MTRRTQRLNIWMNGQRVGYWEKKRGEESLSYAQEWLANEQGRPL
Download Length: 135 bp
Antitoxin
Download Length: 105 a.a. Molecular weight: 11566.42 Da Isoelectric Point: 10.3196
>AT264265 WP_186368366.1 NZ_CP110791:3972579-3972893 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MDYPIKILSQLRPTLIGFRKNKGLTQASLAQLLGITQQSYAKLEANPASASVERLFKILHLLDIELILGEKKNASSHPSK
THPSEKSPAINLPSKHLPSKQEDW
MDYPIKILSQLRPTLIGFRKNKGLTQASLAQLLGITQQSYAKLEANPASASVERLFKILHLLDIELILGEKKNASSHPSK
THPSEKSPAINLPSKHLPSKQEDW
Download Length: 315 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|