Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 2440774..2441287 Replicon chromosome
Accession NZ_CP110791
Organism Yersinia sp. SCPM-O-B-9106 (C-191)

Toxin (Protein)


Gene name relE Uniprot ID A0A386HFI9
Locus tag OP863_RS11230 Protein ID WP_038632447.1
Coordinates 2441003..2441287 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A386HFF3
Locus tag OP863_RS11225 Protein ID WP_012105237.1
Coordinates 2440774..2441013 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OP863_RS11200 (OP863_11200) 2436027..2436221 + 195 WP_038632469.1 hypothetical protein -
OP863_RS11205 (OP863_11205) 2436560..2437771 + 1212 WP_265525260.1 sodium/glutamate symporter -
OP863_RS11210 (OP863_11210) 2437891..2438763 - 873 WP_145592025.1 23S rRNA pseudouridine(2604) synthase RluF -
OP863_RS11215 (OP863_11215) 2439032..2440195 + 1164 WP_071841717.1 class C beta-lactamase -
OP863_RS11220 (OP863_11220) 2440411..2440647 - 237 WP_265525261.1 hypothetical protein -
OP863_RS11225 (OP863_11225) 2440774..2441013 + 240 WP_012105237.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OP863_RS11230 (OP863_11230) 2441003..2441287 + 285 WP_038632447.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OP863_RS11235 (OP863_11235) 2441298..2441912 - 615 Protein_2180 terminase small subunit -
OP863_RS11240 (OP863_11240) 2442005..2442460 + 456 WP_145592026.1 siphovirus Gp157 family protein -
OP863_RS11245 (OP863_11245) 2442533..2442799 + 267 WP_265525262.1 excisionase -
OP863_RS11250 (OP863_11250) 2442774..2443856 + 1083 WP_265525263.1 phage integrase Arm DNA-binding domain-containing protein -
OP863_RS11255 (OP863_11255) 2444113..2444325 + 213 WP_265525264.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2440411..2509942 69531


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(2-76)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11172.92 Da        Isoelectric Point: 10.1967

>T264257 WP_038632447.1 NZ_CP110791:2441003-2441287 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MTYNLDFDRRALKEWHKLGDTVRQQFKKKLLEVIKNPRVEANKLRDLPDCYKIKLRSAGYRLIYQVQDEKITVFVVAVGK
RDREEAYSEAGNRV

Download         Length: 285 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8836.12 Da        Isoelectric Point: 4.5105

>AT264257 WP_012105237.1 NZ_CP110791:2440774-2441013 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MGNINIRIDDDLKDRSYAVLEKLGVTPSDLLRQTLEYVAQSGKLPFKSVLLTDEDQALVAVVRERLANPQPVRVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References