Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2440774..2441287 | Replicon | chromosome |
| Accession | NZ_CP110791 | ||
| Organism | Yersinia sp. SCPM-O-B-9106 (C-191) | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A386HFI9 |
| Locus tag | OP863_RS11230 | Protein ID | WP_038632447.1 |
| Coordinates | 2441003..2441287 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A386HFF3 |
| Locus tag | OP863_RS11225 | Protein ID | WP_012105237.1 |
| Coordinates | 2440774..2441013 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OP863_RS11200 (OP863_11200) | 2436027..2436221 | + | 195 | WP_038632469.1 | hypothetical protein | - |
| OP863_RS11205 (OP863_11205) | 2436560..2437771 | + | 1212 | WP_265525260.1 | sodium/glutamate symporter | - |
| OP863_RS11210 (OP863_11210) | 2437891..2438763 | - | 873 | WP_145592025.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| OP863_RS11215 (OP863_11215) | 2439032..2440195 | + | 1164 | WP_071841717.1 | class C beta-lactamase | - |
| OP863_RS11220 (OP863_11220) | 2440411..2440647 | - | 237 | WP_265525261.1 | hypothetical protein | - |
| OP863_RS11225 (OP863_11225) | 2440774..2441013 | + | 240 | WP_012105237.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OP863_RS11230 (OP863_11230) | 2441003..2441287 | + | 285 | WP_038632447.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OP863_RS11235 (OP863_11235) | 2441298..2441912 | - | 615 | Protein_2180 | terminase small subunit | - |
| OP863_RS11240 (OP863_11240) | 2442005..2442460 | + | 456 | WP_145592026.1 | siphovirus Gp157 family protein | - |
| OP863_RS11245 (OP863_11245) | 2442533..2442799 | + | 267 | WP_265525262.1 | excisionase | - |
| OP863_RS11250 (OP863_11250) | 2442774..2443856 | + | 1083 | WP_265525263.1 | phage integrase Arm DNA-binding domain-containing protein | - |
| OP863_RS11255 (OP863_11255) | 2444113..2444325 | + | 213 | WP_265525264.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2440411..2509942 | 69531 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11172.92 Da Isoelectric Point: 10.1967
>T264257 WP_038632447.1 NZ_CP110791:2441003-2441287 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MTYNLDFDRRALKEWHKLGDTVRQQFKKKLLEVIKNPRVEANKLRDLPDCYKIKLRSAGYRLIYQVQDEKITVFVVAVGK
RDREEAYSEAGNRV
MTYNLDFDRRALKEWHKLGDTVRQQFKKKLLEVIKNPRVEANKLRDLPDCYKIKLRSAGYRLIYQVQDEKITVFVVAVGK
RDREEAYSEAGNRV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|