Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1265218..1265753 | Replicon | chromosome |
Accession | NZ_CP110791 | ||
Organism | Yersinia sp. SCPM-O-B-9106 (C-191) |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A386HCD1 |
Locus tag | OP863_RS05735 | Protein ID | WP_038635036.1 |
Coordinates | 1265466..1265753 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A386HCJ9 |
Locus tag | OP863_RS05730 | Protein ID | WP_038635039.1 |
Coordinates | 1265218..1265469 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OP863_RS05705 (OP863_05705) | 1260689..1261192 | + | 504 | WP_265525972.1 | ferredoxin-type protein NapF | - |
OP863_RS05710 (OP863_05710) | 1261182..1261448 | + | 267 | WP_019081761.1 | chaperone NapD | - |
OP863_RS05715 (OP863_05715) | 1261445..1263940 | + | 2496 | WP_038635047.1 | nitrate reductase catalytic subunit NapA | - |
OP863_RS05720 (OP863_05720) | 1263975..1264442 | + | 468 | WP_038635044.1 | nitrate reductase cytochrome c-type subunit | - |
OP863_RS05725 (OP863_05725) | 1264470..1265069 | + | 600 | WP_145588881.1 | cytochrome c-type protein NapC | - |
OP863_RS05730 (OP863_05730) | 1265218..1265469 | + | 252 | WP_038635039.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OP863_RS05735 (OP863_05735) | 1265466..1265753 | + | 288 | WP_038635036.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OP863_RS05740 (OP863_05740) | 1265782..1266357 | + | 576 | WP_038635033.1 | GDP-mannose pyrophosphatase NudK | - |
OP863_RS05745 (OP863_05745) | 1266601..1268880 | + | 2280 | WP_038635031.1 | NADP-dependent oxaloacetate-decarboxylating malate dehydrogenase | - |
OP863_RS05750 (OP863_05750) | 1269031..1269504 | - | 474 | WP_038635028.1 | YaiI/YqxD family protein | - |
OP863_RS05755 (OP863_05755) | 1269504..1270430 | - | 927 | WP_265525973.1 | oxygen-dependent coproporphyrinogen oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11215.24 Da Isoelectric Point: 10.3200
>T264255 WP_038635036.1 NZ_CP110791:1265466-1265753 [Yersinia sp. SCPM-O-B-9106 (C-191)]
MIYTVKFREEALKEWHKLDKTIQQQFAKKLKKCSDNPHIESAKLRGMKDCYKIKLRSSGFRLVYEVIDDILIVAVVAVGK
RERSEVYKLASERLR
MIYTVKFREEALKEWHKLDKTIQQQFAKKLKKCSDNPHIESAKLRGMKDCYKIKLRSSGFRLVYEVIDDILIVAVVAVGK
RERSEVYKLASERLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|