Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4724696..4725486 | Replicon | chromosome |
Accession | NZ_CP110782 | ||
Organism | Pseudomonas putida DOT-T1E |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | OPZ46_RS21755 | Protein ID | WP_014859916.1 |
Coordinates | 4725019..4725486 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | I7C311 |
Locus tag | OPZ46_RS21750 | Protein ID | WP_014859917.1 |
Coordinates | 4724696..4725022 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPZ46_RS21730 (OPZ46_21730) | 4720211..4721272 | - | 1062 | WP_014859921.1 | HlyD family secretion protein | - |
OPZ46_RS21735 (OPZ46_21735) | 4721301..4722842 | - | 1542 | WP_014859920.1 | MFS transporter | - |
OPZ46_RS21740 (OPZ46_21740) | 4722978..4723883 | - | 906 | WP_014859919.1 | LysR family transcriptional regulator | - |
OPZ46_RS21745 (OPZ46_21745) | 4724157..4724603 | + | 447 | WP_014859918.1 | universal stress protein | - |
OPZ46_RS21750 (OPZ46_21750) | 4724696..4725022 | + | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
OPZ46_RS21755 (OPZ46_21755) | 4725019..4725486 | + | 468 | WP_014859916.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
OPZ46_RS21760 (OPZ46_21760) | 4725559..4726419 | - | 861 | WP_014859915.1 | HlyD family secretion protein | - |
OPZ46_RS21765 (OPZ46_21765) | 4726430..4726630 | - | 201 | WP_014859914.1 | DUF1656 domain-containing protein | - |
OPZ46_RS21770 (OPZ46_21770) | 4726620..4728797 | - | 2178 | WP_003251716.1 | FUSC family protein | - |
OPZ46_RS21775 (OPZ46_21775) | 4728794..4730323 | - | 1530 | WP_014859913.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17998.38 Da Isoelectric Point: 9.7964
>T264218 WP_014859916.1 NZ_CP110782:4725019-4725486 [Pseudomonas putida DOT-T1E]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESNDDAYKVFQKMLHSGHPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESNDDAYKVFQKMLHSGHPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|