Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 251159..251729 | Replicon | chromosome |
| Accession | NZ_CP110644 | ||
| Organism | Pseudomonas sp. KU26590 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OKW98_RS01190 | Protein ID | WP_265387640.1 |
| Coordinates | 251445..251729 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OKW98_RS01185 | Protein ID | WP_265387639.1 |
| Coordinates | 251159..251458 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKW98_RS01155 (OKW98_01155) | 246350..247687 | - | 1338 | WP_037016614.1 | ammonium transporter | - |
| OKW98_RS01160 (OKW98_01160) | 247722..248060 | - | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
| OKW98_RS01165 (OKW98_01165) | 248478..248762 | + | 285 | WP_265387636.1 | accessory factor UbiK family protein | - |
| OKW98_RS01170 (OKW98_01170) | 248783..248935 | - | 153 | Protein_230 | addiction module antidote protein, HigA family | - |
| OKW98_RS01175 (OKW98_01175) | 248954..249487 | - | 534 | WP_265387637.1 | GNAT family N-acetyltransferase | - |
| OKW98_RS01180 (OKW98_01180) | 249604..251097 | + | 1494 | WP_265387638.1 | YifB family Mg chelatase-like AAA ATPase | - |
| OKW98_RS01185 (OKW98_01185) | 251159..251458 | + | 300 | WP_265387639.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OKW98_RS01190 (OKW98_01190) | 251445..251729 | + | 285 | WP_265387640.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OKW98_RS01195 (OKW98_01195) | 251765..253741 | - | 1977 | WP_265387641.1 | methyl-accepting chemotaxis protein | - |
| OKW98_RS01200 (OKW98_01200) | 253960..254880 | - | 921 | WP_133773820.1 | LysR substrate-binding domain-containing protein | - |
| OKW98_RS01205 (OKW98_01205) | 255046..256428 | + | 1383 | WP_265389619.1 | NorM family multidrug efflux MATE transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10709.39 Da Isoelectric Point: 8.4794
>T264069 WP_265387640.1 NZ_CP110644:251445-251729 [Pseudomonas sp. KU26590]
VLTIEWSKYARDDLLAILEYVAGHDAKAAWRLKEEIDVRIGHLPRHPRLYKAGREAGTREIVVAPNYLVVYAETPTTLLI
LRVLHAAQQWPPNA
VLTIEWSKYARDDLLAILEYVAGHDAKAAWRLKEEIDVRIGHLPRHPRLYKAGREAGTREIVVAPNYLVVYAETPTTLLI
LRVLHAAQQWPPNA
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|