Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 253200..253796 | Replicon | chromosome |
| Accession | NZ_CP110534 | ||
| Organism | Enterobacter roggenkampii strain WS28-4 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A837YNH1 |
| Locus tag | OM420_RS01120 | Protein ID | WP_049121167.1 |
| Coordinates | 253494..253796 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | W7P674 |
| Locus tag | OM420_RS01115 | Protein ID | WP_021242718.1 |
| Coordinates | 253200..253487 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM420_RS01110 (OM420_01110) | 251572..253203 | + | 1632 | WP_008503411.1 | Na/Pi cotransporter family protein | - |
| OM420_RS01115 (OM420_01115) | 253200..253487 | - | 288 | WP_021242718.1 | putative addiction module antidote protein | Antitoxin |
| OM420_RS01120 (OM420_01120) | 253494..253796 | - | 303 | WP_049121167.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM420_RS01125 (OM420_01125) | 253994..254866 | + | 873 | WP_008503414.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| OM420_RS01130 (OM420_01130) | 254867..255139 | - | 273 | WP_014830263.1 | DUF3811 domain-containing protein | - |
| OM420_RS01135 (OM420_01135) | 255190..256134 | - | 945 | WP_277695881.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| OM420_RS01140 (OM420_01140) | 256240..257814 | - | 1575 | WP_039024657.1 | RNA repair transcriptional activator RtcR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11486.26 Da Isoelectric Point: 10.1771
>T263940 WP_049121167.1 NZ_CP110534:c253796-253494 [Enterobacter roggenkampii]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLNNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLNNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837YNH1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7P674 |