Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 63515..64301 Replicon plasmid pRWS292.s3
Accession NZ_CP110526
Organism Klebsiella pneumoniae strain WS_29-2

Toxin (Protein)


Gene name yeeV Uniprot ID R8WN26
Locus tag OM422_RS28895 Protein ID WP_016154457.1
Coordinates 63515..63892 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A242VSK1
Locus tag OM422_RS28900 Protein ID WP_009652436.1
Coordinates 63942..64301 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM422_RS28860 (OM422_28840) 58537..58893 - 357 Protein_55 tellurium resistance protein TerY -
OM422_RS28865 (OM422_28845) 58953..59921 - 969 WP_080453768.1 IS5-like element IS903B family transposase -
OM422_RS28870 (OM422_28850) 60161..60634 - 474 WP_009652494.1 ribbon-helix-helix protein, CopG family -
OM422_RS28875 (OM422_28855) 60637..61668 - 1032 WP_223175620.1 hypothetical protein -
OM422_RS28880 (OM422_28860) 61868..62713 - 846 Protein_59 DUF4942 domain-containing protein -
OM422_RS28885 (OM422_28865) 62794..62997 - 204 WP_009652505.1 DUF957 domain-containing protein -
OM422_RS28890 (OM422_28870) 63027..63518 - 492 WP_009652438.1 DUF5983 family protein -
OM422_RS28895 (OM422_28875) 63515..63892 - 378 WP_016154457.1 TA system toxin CbtA family protein Toxin
OM422_RS28900 (OM422_28880) 63942..64301 - 360 WP_009652436.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OM422_RS28905 (OM422_28885) 64325..64546 - 222 WP_009652392.1 DUF987 domain-containing protein -
OM422_RS28910 (OM422_28890) 64560..65042 - 483 WP_016154455.1 DNA repair protein RadC -
OM422_RS28915 (OM422_28895) 65054..65272 - 219 WP_009652503.1 hypothetical protein -
OM422_RS28920 (OM422_28900) 65283..65756 - 474 WP_009652453.1 antirestriction protein -
OM422_RS28925 (OM422_28905) 65773..66027 - 255 WP_009652519.1 hypothetical protein -
OM422_RS28930 (OM422_28910) 66027..66845 - 819 WP_009652424.1 DUF932 domain-containing protein -
OM422_RS28935 (OM422_28915) 66949..67182 - 234 WP_009652474.1 DUF905 domain-containing protein -
OM422_RS28940 (OM422_28920) 67238..67459 - 222 WP_009652443.1 hypothetical protein -
OM422_RS28945 (OM422_28925) 67542..68054 - 513 WP_009652395.1 DUF4234 domain-containing protein -
OM422_RS28950 (OM422_28930) 68103..68573 - 471 WP_009652431.1 hypothetical protein -
OM422_RS28955 (OM422_28935) 68620..68931 - 312 WP_009652410.1 hypothetical protein -
OM422_RS28960 (OM422_28940) 68944..69210 - 267 WP_009652486.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..213187 213187
- flank IS/Tn - - 58953..59921 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14168.19 Da        Isoelectric Point: 9.5224

>T263916 WP_016154457.1 NZ_CP110526:c63892-63515 [Klebsiella pneumoniae]
MQTQPVPPKREVSPRPSPVAIWQRLLSHLLDRHYGLTLNDTPFGKDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLTSIDILRARKATGLMTRHSYRAVTDITTGKYREVQP

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13286.19 Da        Isoelectric Point: 6.4780

>AT263916 WP_009652436.1 NZ_CP110526:c64301-63942 [Klebsiella pneumoniae]
MSNTIPPVNHDIAAPWWGLKRDITPCFGARLVQEGNRLHYLNDRASITGTFSDADLRHLDQAFPLLLKQLELMLLSGELN
PRHQHCVTLYAKGLICEADSLGSHGYVYLAIYPTPATTE

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R8WN26

Antitoxin

Source ID Structure
AlphaFold DB A0A242VSK1

References