Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 63515..64301 Replicon plasmid pRWS291.s3
Accession NZ_CP110517
Organism Klebsiella pneumoniae strain WS_29-1

Toxin (Protein)


Gene name yeeV Uniprot ID R8WN26
Locus tag OM421_RS28770 Protein ID WP_016154457.1
Coordinates 63515..63892 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A242VSK1
Locus tag OM421_RS28775 Protein ID WP_009652436.1
Coordinates 63942..64301 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM421_RS28735 (OM421_28725) 58537..58893 - 357 Protein_55 tellurium resistance protein TerY -
OM421_RS28740 (OM421_28730) 58953..59921 - 969 WP_080453768.1 IS5-like element IS903B family transposase -
OM421_RS28745 (OM421_28735) 60161..60634 - 474 WP_009652494.1 ribbon-helix-helix protein, CopG family -
OM421_RS28750 (OM421_28740) 60637..61668 - 1032 WP_223175620.1 hypothetical protein -
OM421_RS28755 (OM421_28745) 61868..62713 - 846 Protein_59 DUF4942 domain-containing protein -
OM421_RS28760 (OM421_28750) 62794..62997 - 204 WP_009652505.1 DUF957 domain-containing protein -
OM421_RS28765 (OM421_28755) 63027..63518 - 492 WP_009652438.1 DUF5983 family protein -
OM421_RS28770 (OM421_28760) 63515..63892 - 378 WP_016154457.1 TA system toxin CbtA family protein Toxin
OM421_RS28775 (OM421_28765) 63942..64301 - 360 WP_009652436.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OM421_RS28780 (OM421_28770) 64325..64546 - 222 WP_009652392.1 DUF987 domain-containing protein -
OM421_RS28785 (OM421_28775) 64560..65042 - 483 WP_016154455.1 DNA repair protein RadC -
OM421_RS28790 (OM421_28780) 65054..65272 - 219 WP_009652503.1 hypothetical protein -
OM421_RS28795 (OM421_28785) 65283..65756 - 474 WP_009652453.1 antirestriction protein -
OM421_RS28800 (OM421_28790) 65773..66027 - 255 WP_009652519.1 hypothetical protein -
OM421_RS28805 (OM421_28795) 66027..66845 - 819 WP_009652424.1 DUF932 domain-containing protein -
OM421_RS28810 (OM421_28800) 66949..67182 - 234 WP_009652474.1 DUF905 domain-containing protein -
OM421_RS28815 (OM421_28805) 67238..67459 - 222 WP_009652443.1 hypothetical protein -
OM421_RS28820 (OM421_28810) 67542..68054 - 513 WP_009652395.1 DUF4234 domain-containing protein -
OM421_RS28825 (OM421_28815) 68103..68573 - 471 WP_009652431.1 hypothetical protein -
OM421_RS28830 (OM421_28820) 68620..68931 - 312 WP_009652410.1 hypothetical protein -
OM421_RS28835 (OM421_28825) 68944..69210 - 267 WP_009652486.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..212886 212886
- flank IS/Tn - - 58953..59921 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14168.19 Da        Isoelectric Point: 9.5224

>T263889 WP_016154457.1 NZ_CP110517:c63892-63515 [Klebsiella pneumoniae]
MQTQPVPPKREVSPRPSPVAIWQRLLSHLLDRHYGLTLNDTPFGKDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLTSIDILRARKATGLMTRHSYRAVTDITTGKYREVQP

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13286.19 Da        Isoelectric Point: 6.4780

>AT263889 WP_009652436.1 NZ_CP110517:c64301-63942 [Klebsiella pneumoniae]
MSNTIPPVNHDIAAPWWGLKRDITPCFGARLVQEGNRLHYLNDRASITGTFSDADLRHLDQAFPLLLKQLELMLLSGELN
PRHQHCVTLYAKGLICEADSLGSHGYVYLAIYPTPATTE

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R8WN26

Antitoxin

Source ID Structure
AlphaFold DB A0A242VSK1

References