Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-ChpS |
| Location | 1466440..1467030 | Replicon | chromosome |
| Accession | NZ_CP110473 | ||
| Organism | Pantoea anthophila strain CL1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | OJ965_RS09310 | Protein ID | WP_265138960.1 |
| Coordinates | 1466698..1467030 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | OJ965_RS09305 | Protein ID | WP_046102165.1 |
| Coordinates | 1466440..1466697 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OJ965_RS09290 (OJ965_09290) | 1461468..1462241 | - | 774 | WP_154927662.1 | PhnD/SsuA/transferrin family substrate-binding protein | - |
| OJ965_RS09295 (OJ965_09295) | 1462461..1463483 | + | 1023 | WP_046102167.1 | LLM class flavin-dependent oxidoreductase | - |
| OJ965_RS09300 (OJ965_09300) | 1463898..1466129 | + | 2232 | WP_009089362.1 | catalase/peroxidase HPI | - |
| OJ965_RS09305 (OJ965_09305) | 1466440..1466697 | + | 258 | WP_046102165.1 | antitoxin | Antitoxin |
| OJ965_RS09310 (OJ965_09310) | 1466698..1467030 | + | 333 | WP_265138960.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OJ965_RS09320 (OJ965_09320) | 1467505..1468626 | + | 1122 | WP_140028954.1 | Gfo/Idh/MocA family oxidoreductase | - |
| OJ965_RS09325 (OJ965_09325) | 1468695..1469525 | - | 831 | WP_265138961.1 | glycosyltransferase family 8 protein | - |
| OJ965_RS09330 (OJ965_09330) | 1469534..1470916 | - | 1383 | WP_140925557.1 | D-arabinono-1,4-lactone oxidase | - |
| OJ965_RS09335 (OJ965_09335) | 1471000..1471632 | - | 633 | WP_046102260.1 | TetR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11993.82 Da Isoelectric Point: 8.5695
>T263834 WP_265138960.1 NZ_CP110473:1466698-1467030 [Pantoea anthophila]
MERGEIWLVTLDPTAGHEQSGRRPVLIVSPASFNAFTRLPIVVPVTRGGNFARAAGFAVSLDGAGCRTKGVVRCDQPRTL
DMEAREGRRLERLPDAIVNEVLARLEAILN
MERGEIWLVTLDPTAGHEQSGRRPVLIVSPASFNAFTRLPIVVPVTRGGNFARAAGFAVSLDGAGCRTKGVVRCDQPRTL
DMEAREGRRLERLPDAIVNEVLARLEAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|