Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5671876..5672471 | Replicon | chromosome |
| Accession | NZ_CP110346 | ||
| Organism | Pseudomonas aeruginosa strain PALA35 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA35_RS26380 | Protein ID | WP_003113526.1 |
| Coordinates | 5672193..5672471 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA35_RS26375 | Protein ID | WP_031638452.1 |
| Coordinates | 5671876..5672181 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA35_RS26340 (PALA35_05214) | 5667017..5667865 | + | 849 | WP_058166986.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| PALA35_RS26350 (PALA35_05216) | 5668032..5668973 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PALA35_RS26355 (PALA35_05217) | 5669090..5669704 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PALA35_RS26360 (PALA35_05218) | 5669746..5670330 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PALA35_RS26365 (PALA35_05219) | 5670371..5671471 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PALA35_RS26375 (PALA35_05221) | 5671876..5672181 | - | 306 | WP_031638452.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA35_RS26380 | 5672193..5672471 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA35_RS26385 | 5672524..5672652 | - | 129 | Protein_5214 | integrase | - |
| PALA35_RS26390 (PALA35_05222) | 5672800..5675028 | + | 2229 | WP_269974514.1 | TonB-dependent receptor | - |
| PALA35_RS26395 (PALA35_05223) | 5675098..5675745 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA35_RS26400 (PALA35_05224) | 5675807..5677045 | - | 1239 | WP_023107901.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T263651 WP_003113526.1 NZ_CP110346:c5672471-5672193 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|