Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 31401..32068 | Replicon | plasmid pA |
| Accession | NZ_CP110302 | ||
| Organism | Xanthomonas citri pv. fuscans strain CFBP 6533 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A3T0G501 |
| Locus tag | OM953_RS22150 | Protein ID | WP_022557732.1 |
| Coordinates | 31401..31817 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U4M4Z6 |
| Locus tag | OM953_RS22155 | Protein ID | WP_022557731.1 |
| Coordinates | 31814..32068 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM953_RS22125 (OM953_22125) | 27131..28450 | + | 1320 | WP_022557736.1 | right-handed parallel beta-helix repeat-containing protein | - |
| OM953_RS22130 (OM953_22130) | 28577..29869 | + | 1293 | WP_033481893.1 | M12 family metallo-peptidase | - |
| OM953_RS22135 (OM953_22135) | 30024..30572 | + | 549 | WP_022557734.1 | DNA topoisomerase | - |
| OM953_RS22140 (OM953_22140) | 30621..30758 | + | 138 | Protein_32 | transposase | - |
| OM953_RS22145 (OM953_22145) | 30833..31387 | - | 555 | WP_033482006.1 | plasmid pRiA4b ORF-3 family protein | - |
| OM953_RS22150 (OM953_22150) | 31401..31817 | - | 417 | WP_022557732.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM953_RS22155 (OM953_22155) | 31814..32068 | - | 255 | WP_022557731.1 | plasmid stability protein | Antitoxin |
| OM953_RS22160 (OM953_22160) | 32280..32873 | + | 594 | WP_022560487.1 | recombinase family protein | - |
| OM953_RS22165 (OM953_22165) | 32870..35899 | + | 3030 | WP_022560486.1 | Tn3 family transposase | - |
| OM953_RS22170 (OM953_22170) | 35932..36890 | + | 959 | Protein_38 | IS3-like element ISXcd1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..57070 | 57070 | |
| - | inside | IScluster/Tn | - | - | 30621..36890 | 6269 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14833.04 Da Isoelectric Point: 4.6812
>T263596 WP_022557732.1 NZ_CP110302:c31817-31401 [Xanthomonas citri pv. fuscans]
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T0G501 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T0G545 |