Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4377183..4377970 Replicon chromosome
Accession NZ_CP110142
Organism Klebsiella pneumoniae strain SBH193

Toxin (Protein)


Gene name yeeV Uniprot ID A0A377E3D6
Locus tag OMD37_RS21720 Protein ID WP_001194695.1
Coordinates 4377593..4377970 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag OMD37_RS21715 Protein ID WP_053266522.1
Coordinates 4377183..4377542 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD37_RS21670 (4372421) 4372421..4372873 + 453 WP_001020418.1 hypothetical protein -
OMD37_RS21675 (4372870) 4372870..4373322 + 453 WP_000734138.1 hypothetical protein -
OMD37_RS21680 (4373385) 4373385..4373928 + 544 Protein_4257 DUF4339 domain-containing protein -
OMD37_RS21685 (4373988) 4373988..4374440 + 453 WP_001061894.1 IrmA family protein -
OMD37_RS21690 (4374517) 4374517..4374750 + 234 WP_001614358.1 DUF905 domain-containing protein -
OMD37_RS21695 (4374870) 4374870..4375688 + 819 WP_001614356.1 DUF932 domain-containing protein -
OMD37_RS21700 (4375956) 4375956..4376426 + 471 WP_000131762.1 antirestriction protein -
OMD37_RS21705 (4376438) 4376438..4376917 + 480 WP_000437750.1 DNA repair protein RadC -
OMD37_RS21710 (4376938) 4376938..4377159 + 222 WP_044068431.1 DUF987 domain-containing protein -
OMD37_RS21715 (4377183) 4377183..4377542 + 360 WP_053266522.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OMD37_RS21720 (4377593) 4377593..4377970 + 378 WP_001194695.1 TA system toxin CbtA family protein Toxin
OMD37_RS21725 (4377967) 4377967..4378458 + 492 WP_000777682.1 DUF5983 family protein -
OMD37_RS21730 (4378498) 4378498..4378692 + 195 WP_032155094.1 DUF957 domain-containing protein -
OMD37_RS21735 (4378773) 4378773..4379617 + 845 Protein_4268 DUF4942 domain-containing protein -
OMD37_RS21745 (4379961) 4379961..4380692 - 732 WP_004152034.1 DNA polymerase III subunit epsilon -
OMD37_RS21750 (4380757) 4380757..4381224 + 468 WP_002889686.1 ribonuclease HI -
OMD37_RS21755 (4381221) 4381221..4381943 - 723 WP_002889685.1 class I SAM-dependent methyltransferase -
OMD37_RS21760 (4381976) 4381976..4382731 + 756 WP_004145833.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4349336..4382731 33395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14180.97 Da        Isoelectric Point: 7.4209

>T263209 WP_001194695.1 NZ_CP110142:4377593-4377970 [Klebsiella pneumoniae]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13109.09 Da        Isoelectric Point: 7.3717

>AT263209 WP_053266522.1 NZ_CP110142:4377183-4377542 [Klebsiella pneumoniae]
MSNKTPIVNHDITEPWWGLKRSITPCFGARLVQAGNCLHYLADRASITGQFSDAVLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377E3D6

Antitoxin

Source ID Structure

References