Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2656318..2656889 | Replicon | chromosome |
Accession | NZ_CP110039 | ||
Organism | Enterococcus faecalis strain BE47 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | OLM03_RS12995 | Protein ID | WP_002360937.1 |
Coordinates | 2656318..2656659 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | OLM03_RS13000 | Protein ID | WP_002354773.1 |
Coordinates | 2656659..2656889 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLM03_RS12990 (2652333) | 2652333..2655947 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
OLM03_RS12995 (2656318) | 2656318..2656659 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OLM03_RS13000 (2656659) | 2656659..2656889 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
OLM03_RS13005 (2657060) | 2657060..2657275 | - | 216 | Protein_2535 | zinc ribbon domain-containing protein | - |
OLM03_RS13010 (2657414) | 2657414..2658406 | + | 993 | WP_016630742.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
OLM03_RS13015 (2658473) | 2658473..2659105 | - | 633 | WP_002358972.1 | RloB family protein | - |
OLM03_RS13020 (2659114) | 2659114..2660409 | - | 1296 | WP_264547459.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T262810 WP_002360937.1 NZ_CP110039:c2656659-2656318 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A812 |