Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2166144..2166975 | Replicon | chromosome |
| Accession | NZ_CP110018 | ||
| Organism | Escherichia coli strain DH10B | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | OLR78_RS10845 | Protein ID | WP_000854814.1 |
| Coordinates | 2166601..2166975 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | OLR78_RS10840 | Protein ID | WP_001285584.1 |
| Coordinates | 2166144..2166512 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLR78_RS10825 (2163811) | 2163811..2165343 | + | 1533 | WP_001350525.1 | protein YeeR | - |
| OLR78_RS10830 (2165340) | 2165340..2165786 | + | 447 | WP_000187523.1 | RadC family protein | - |
| OLR78_RS10835 (2165849) | 2165849..2166070 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| OLR78_RS10840 (2166144) | 2166144..2166512 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| OLR78_RS10845 (2166601) | 2166601..2166975 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| OLR78_RS10850 (2166972) | 2166972..2167166 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| OLR78_RS10855 (2167212) | 2167212..2167292 | + | 81 | Protein_2122 | hypothetical protein | - |
| OLR78_RS10860 (2167581) | 2167581..2167709 | - | 129 | Protein_2123 | transposase domain-containing protein | - |
| OLR78_RS10865 (2167829) | 2167829..2167963 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| OLR78_RS10870 (2168064) | 2168064..2168393 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| OLR78_RS10875 (2168565) | 2168565..2169623 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| OLR78_RS10880 (2169821) | 2169821..2170294 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| OLR78_RS10885 (2170413) | 2170413..2171579 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T262750 WP_000854814.1 NZ_CP110018:2166601-2166975 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT262750 WP_001285584.1 NZ_CP110018:2166144-2166512 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |