Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 3002020..3002615 | Replicon | chromosome |
| Accession | NZ_CP109953 | ||
| Organism | Escherichia coli strain NC22 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | OI124_RS14550 | Protein ID | WP_000239579.1 |
| Coordinates | 3002020..3002370 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | OI124_RS14555 | Protein ID | WP_001223208.1 |
| Coordinates | 3002364..3002615 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI124_RS14530 (2997280) | 2997280..2998302 | - | 1023 | WP_001339490.1 | ABC transporter permease | - |
| OI124_RS14535 (2998316) | 2998316..2999818 | - | 1503 | WP_000205793.1 | sugar ABC transporter ATP-binding protein | - |
| OI124_RS14540 (3000128) | 3000128..3001100 | - | 973 | Protein_2839 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| OI124_RS14545 (3001410) | 3001410..3001940 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
| OI124_RS14550 (3002020) | 3002020..3002370 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| OI124_RS14555 (3002364) | 3002364..3002615 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| OI124_RS14560 (3002828) | 3002828..3003169 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| OI124_RS14565 (3003172) | 3003172..3006951 | - | 3780 | WP_048943320.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T262528 WP_000239579.1 NZ_CP109953:c3002370-3002020 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |