Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4640261..4640942 | Replicon | chromosome |
| Accession | NZ_CP109919 | ||
| Organism | Pseudomonas aeruginosa strain PALA56 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6AKP0 |
| Locus tag | PALA56_RS21695 | Protein ID | WP_003111825.1 |
| Coordinates | 4640577..4640942 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1C7BMJ2 |
| Locus tag | PALA56_RS21690 | Protein ID | WP_003159602.1 |
| Coordinates | 4640261..4640584 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA56_RS21655 (PALA56_04311) | 4636220..4636903 | - | 684 | WP_003120766.1 | TetR/AcrR family transcriptional regulator | - |
| PALA56_RS21660 (PALA56_04312) | 4636991..4637869 | + | 879 | WP_014603214.1 | hypothetical protein | - |
| PALA56_RS21670 | 4638472..4638699 | + | 228 | WP_014603215.1 | hypothetical protein | - |
| PALA56_RS21675 | 4638714..4639639 | - | 926 | Protein_4286 | tyrosine-type recombinase/integrase | - |
| PALA56_RS21680 (PALA56_04315) | 4639639..4640031 | - | 393 | Protein_4287 | hypothetical protein | - |
| PALA56_RS21685 | 4640026..4640145 | + | 120 | Protein_4288 | IS5/IS1182 family transposase | - |
| PALA56_RS21690 (PALA56_04316) | 4640261..4640584 | - | 324 | WP_003159602.1 | XRE family transcriptional regulator | Antitoxin |
| PALA56_RS21695 | 4640577..4640942 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA56_RS21700 | 4641233..4641407 | - | 175 | Protein_4291 | hypothetical protein | - |
| PALA56_RS21705 (PALA56_04317) | 4641614..4641886 | + | 273 | WP_014603216.1 | hypothetical protein | - |
| PALA56_RS21710 (PALA56_04318) | 4641916..4642341 | - | 426 | WP_003116492.1 | VOC family protein | - |
| PALA56_RS21715 (PALA56_04319) | 4642442..4643326 | + | 885 | WP_003085663.1 | LysR substrate-binding domain-containing protein | - |
| PALA56_RS21720 (PALA56_04320) | 4643299..4644252 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
| PALA56_RS21725 (PALA56_04321) | 4644473..4644907 | + | 435 | WP_003116494.1 | RidA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T262340 WP_003111825.1 NZ_CP109919:c4640942-4640577 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6AKP0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C7BMJ2 |