Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 141509..142014 | Replicon | chromosome |
| Accession | NZ_CP109919 | ||
| Organism | Pseudomonas aeruginosa strain PALA56 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PALA56_RS00645 | Protein ID | WP_003083773.1 |
| Coordinates | 141509..141790 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PALA56_RS00650 | Protein ID | WP_003083775.1 |
| Coordinates | 141787..142014 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA56_RS00620 (PALA56_00122) | 136760..138109 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| PALA56_RS00625 (PALA56_00123) | 138158..138844 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| PALA56_RS00630 (PALA56_00124) | 138945..139679 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| PALA56_RS00635 (PALA56_00125) | 139859..140269 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| PALA56_RS00640 (PALA56_00126) | 140301..141209 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| PALA56_RS00645 (PALA56_00127) | 141509..141790 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PALA56_RS00650 (PALA56_00128) | 141787..142014 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA56_RS00655 (PALA56_00129) | 142190..142810 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| PALA56_RS00660 (PALA56_00130) | 142911..143411 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| PALA56_RS00665 (PALA56_00131) | 143484..143825 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PALA56_RS00670 (PALA56_00132) | 143907..145334 | - | 1428 | WP_003083784.1 | GABA permease | - |
| PALA56_RS00675 (PALA56_00133) | 145503..146996 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T262336 WP_003083773.1 NZ_CP109919:c141790-141509 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|