Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4114819..4115500 | Replicon | chromosome |
| Accession | NZ_CP109850 | ||
| Organism | Pseudomonas aeruginosa strain PALA37 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PALA37_RS19130 | Protein ID | WP_031639878.1 |
| Coordinates | 4114819..4115184 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA37_RS19135 | Protein ID | WP_003145733.1 |
| Coordinates | 4115177..4115500 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA37_RS19100 (PALA37_03782) | 4110812..4111246 | - | 435 | WP_003158601.1 | RidA family protein | - |
| PALA37_RS19105 (PALA37_03783) | 4111467..4112420 | + | 954 | WP_023435500.1 | LysR substrate-binding domain-containing protein | - |
| PALA37_RS19110 (PALA37_03784) | 4112393..4113277 | - | 885 | WP_009875989.1 | LysR family transcriptional regulator | - |
| PALA37_RS19115 (PALA37_03785) | 4113378..4113803 | + | 426 | WP_023435499.1 | VOC family protein | - |
| PALA37_RS19120 (PALA37_03786) | 4113834..4114106 | - | 273 | WP_058172074.1 | hypothetical protein | - |
| PALA37_RS19125 | 4114313..4114555 | + | 243 | WP_049955787.1 | hypothetical protein | - |
| PALA37_RS19130 | 4114819..4115184 | + | 366 | WP_031639878.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA37_RS19135 (PALA37_03787) | 4115177..4115500 | + | 324 | WP_003145733.1 | XRE family transcriptional regulator | Antitoxin |
| PALA37_RS19140 (PALA37_03788) | 4115870..4116958 | - | 1089 | WP_128552468.1 | DUF3396 domain-containing protein | - |
| PALA37_RS19145 (PALA37_03789) | 4116975..4117673 | - | 699 | WP_270132630.1 | VRR-NUC domain-containing protein | - |
| PALA37_RS19150 (PALA37_03790) | 4117670..4118188 | - | 519 | WP_012614469.1 | PAAR domain-containing protein | - |
| PALA37_RS19155 | 4118362..4118697 | - | 336 | Protein_3770 | TM2 domain-containing protein | - |
| PALA37_RS19160 (PALA37_03792) | 4118938..4119576 | - | 639 | WP_003109444.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13970.32 Da Isoelectric Point: 4.8219
>T262210 WP_031639878.1 NZ_CP109850:4114819-4115184 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSDINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDYRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSDINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDYRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|