Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3468886..3469481 | Replicon | chromosome |
| Accession | NZ_CP109850 | ||
| Organism | Pseudomonas aeruginosa strain PALA37 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A6N0KDU0 |
| Locus tag | PALA37_RS16170 | Protein ID | WP_023436306.1 |
| Coordinates | 3468886..3469164 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA37_RS16175 | Protein ID | WP_003133769.1 |
| Coordinates | 3469176..3469481 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA37_RS16150 (PALA37_03199) | 3464312..3465550 | + | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
| PALA37_RS16155 (PALA37_03200) | 3465612..3466259 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA37_RS16160 (PALA37_03201) | 3466329..3468557 | - | 2229 | WP_270132120.1 | TonB-dependent receptor | - |
| PALA37_RS16165 | 3468705..3468833 | + | 129 | Protein_3186 | integrase | - |
| PALA37_RS16170 | 3468886..3469164 | + | 279 | WP_023436306.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA37_RS16175 (PALA37_03202) | 3469176..3469481 | + | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA37_RS16185 (PALA37_03204) | 3469779..3470909 | - | 1131 | WP_057384474.1 | AraC family transcriptional regulator ligand-binding domain-containing protein | - |
| PALA37_RS16190 (PALA37_03205) | 3471204..3472130 | + | 927 | WP_009316208.1 | triacylglycerol lipase | - |
| PALA37_RS16195 (PALA37_03206) | 3472210..3473253 | + | 1044 | WP_270132127.1 | lipase secretion chaperone | - |
| PALA37_RS16200 (PALA37_03207) | 3473339..3474439 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10588.11 Da Isoelectric Point: 7.2451
>T262208 WP_023436306.1 NZ_CP109850:3468886-3469164 [Pseudomonas aeruginosa]
MILTFRCDEARQLFETGLSRQWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDEARQLFETGLSRQWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|