Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 2226775..2227280 | Replicon | chromosome |
| Accession | NZ_CP109850 | ||
| Organism | Pseudomonas aeruginosa strain PALA37 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PALA37_RS10505 | Protein ID | WP_003083773.1 |
| Coordinates | 2226999..2227280 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A0H2ZJU8 |
| Locus tag | PALA37_RS10500 | Protein ID | WP_003137009.1 |
| Coordinates | 2226775..2227002 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA37_RS10475 (PALA37_02083) | 2221790..2223283 | + | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| PALA37_RS10480 (PALA37_02084) | 2223452..2224879 | + | 1428 | WP_023092260.1 | GABA permease | - |
| PALA37_RS10485 (PALA37_02085) | 2224964..2225305 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PALA37_RS10490 (PALA37_02086) | 2225378..2225878 | - | 501 | WP_270135252.1 | LEA type 2 family protein | - |
| PALA37_RS10495 (PALA37_02087) | 2225979..2226599 | + | 621 | WP_003101226.1 | hypothetical protein | - |
| PALA37_RS10500 (PALA37_02088) | 2226775..2227002 | + | 228 | WP_003137009.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA37_RS10505 (PALA37_02089) | 2226999..2227280 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PALA37_RS10510 (PALA37_02090) | 2227580..2228488 | + | 909 | WP_198341046.1 | LysR family transcriptional regulator | - |
| PALA37_RS10515 (PALA37_02091) | 2228520..2228930 | - | 411 | WP_003110659.1 | aegerolysin family protein | - |
| PALA37_RS10520 (PALA37_02092) | 2229110..2229844 | - | 735 | WP_023107524.1 | GntR family transcriptional regulator | - |
| PALA37_RS10525 (PALA37_02093) | 2229945..2230631 | - | 687 | WP_033888123.1 | FadR/GntR family transcriptional regulator | - |
| PALA37_RS10530 (PALA37_02094) | 2230680..2232029 | - | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T262207 WP_003083773.1 NZ_CP109850:2226999-2227280 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|