Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5472621..5473216 | Replicon | chromosome |
| Accession | NZ_CP109657 | ||
| Organism | Pseudomonas aeruginosa strain Zw26 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | OBG92_RS25860 | Protein ID | WP_003113526.1 |
| Coordinates | 5472938..5473216 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OBG92_RS25855 | Protein ID | WP_034079919.1 |
| Coordinates | 5472621..5472926 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OBG92_RS25830 (OBG92_05086) | 5467625..5468725 | + | 1101 | WP_003151685.1 | redox-regulated ATPase YchF | - |
| OBG92_RS25835 (OBG92_05087) | 5468797..5469846 | - | 1050 | WP_058145931.1 | lipase secretion chaperone | - |
| OBG92_RS25840 (OBG92_05088) | 5469927..5470856 | - | 930 | WP_012077421.1 | triacylglycerol lipase | - |
| OBG92_RS25845 (OBG92_05089) | 5471124..5472233 | + | 1110 | WP_170870656.1 | AraC family transcriptional regulator | - |
| OBG92_RS25855 (OBG92_05091) | 5472621..5472926 | - | 306 | WP_034079919.1 | HigA family addiction module antitoxin | Antitoxin |
| OBG92_RS25860 | 5472938..5473216 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OBG92_RS25865 | 5473269..5473588 | - | 320 | Protein_5110 | tyrosine-type recombinase/integrase | - |
| OBG92_RS25870 (OBG92_05092) | 5473888..5474091 | + | 204 | WP_033976173.1 | hypothetical protein | - |
| OBG92_RS25875 (OBG92_05093) | 5474332..5476191 | + | 1860 | WP_003156877.1 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T261975 WP_003113526.1 NZ_CP109657:c5473216-5472938 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|