Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 39145..39704 Replicon plasmid p1
Accession NZ_CP109602
Organism Escherichia coli strain TL-14

Toxin (Protein)


Gene name relE Uniprot ID U9YB49
Locus tag OGV15_RS23400 Protein ID WP_000421259.1
Coordinates 39145..39420 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2A3UPL5
Locus tag OGV15_RS23405 Protein ID WP_044864180.1
Coordinates 39420..39704 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGV15_RS23385 (34272) 34272..35108 + 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
OGV15_RS23390 (35453) 35453..38584 - 3132 WP_050947969.1 hypothetical protein -
OGV15_RS23395 (38844) 38844..39047 - 204 Protein_34 hypothetical protein -
OGV15_RS23400 (39145) 39145..39420 - 276 WP_000421259.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OGV15_RS23405 (39420) 39420..39704 - 285 WP_044864180.1 ribbon-helix-helix domain-containing protein Antitoxin
OGV15_RS23410 (40072) 40072..41049 - 978 WP_050947967.1 DUF4238 domain-containing protein -
OGV15_RS23415 (41190) 41190..41489 - 300 WP_016241863.1 type II toxin-antitoxin system RelE/ParE family toxin -
OGV15_RS23420 (41479) 41479..41742 - 264 WP_016241862.1 hypothetical protein -
OGV15_RS23425 (42751) 42751..43608 - 858 WP_000131011.1 incFII family plasmid replication initiator RepA -
OGV15_RS23430 (43601) 43601..43675 - 75 WP_001365705.1 RepA leader peptide Tap -
OGV15_RS23435 (43724) 43724..43849 + 126 WP_015059569.1 hypothetical protein -
OGV15_RS23440 (43922) 43922..44170 - 249 WP_021512942.1 replication regulatory protein RepA -
OGV15_RS23445 (44454) 44454..44603 - 150 WP_001300273.1 Hok/Gef family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / tet(B) / aph(3'')-Ib / aph(6)-Id espP / faeJ / faeI / faeH / faeF / faeE / faeD / faeC 1..145661 145661


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10736.45 Da        Isoelectric Point: 9.9324

>T261866 WP_000421259.1 NZ_CP109602:c39420-39145 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10560.00 Da        Isoelectric Point: 5.6558

>AT261866 WP_044864180.1 NZ_CP109602:c39704-39420 [Escherichia coli]
MQMKNNTAQTTKVITAHVPLPMADKIDQMAARLERSRGWIIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLNTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YB49

Antitoxin

Source ID Structure
AlphaFold DB A0A2A3UPL5

References