Detailed information of TA system TA260937

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 101578..101847
• Replicon: plasmid unnamed1
• Accession: NZ_CP107364
• Organism: Klebsiella pneumoniae strain CRKP_33

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH511_RS27475
• Protein ID: WP_001372321.1
• Coordinates: 101722..101847 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	101578..101643 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH511_RS27445	97288..97815	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH511_RS27450	97873..98106	+	234	WP_000006003.1	DUF905 family protein	-
OH511_RS27455	98167..100190	+	2024	Protein_135	ParB/RepB/Spo0J family partition protein	-
OH511_RS27460	100259..100693	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH511_RS27465	100690..101409	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	101421..101645	+	225	NuclAT_0	-	-
-	101421..101645	+	225	NuclAT_0	-	-
-	101421..101645	+	225	NuclAT_0	-	-
-	101421..101645	+	225	NuclAT_0	-	-
-	101578..101643	-	66	-	-	Antitoxin
OH511_RS27470	101631..101780	+	150	Protein_138	plasmid maintenance protein Mok	-
OH511_RS27475	101722..101847	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH511_RS27480	102166..102462	-	297	Protein_140	hypothetical protein	-
OH511_RS27485	102962..103666	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
OH511_RS27490	104135..104698	-	564	WP_155082050.1	hypothetical protein	-
OH511_RS27495	104820..105362	-	543	WP_077273850.1	restriction endonuclease	-
OH511_RS27500	105344..106324	-	981	WP_000019473.1	IS5-like element ISKpn26 family transposase	-
OH511_RS27505	106393..106785	+	393	Protein_145	3'-5' exonuclease	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB	-	1..121138	121138

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T260937 WP_001372321.1 NZ_CP107364:101722-101847 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT260937 NZ_CP107364:c101643-101578 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin