Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59853..60106 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107364 | ||
| Organism | Klebsiella pneumoniae strain CRKP_33 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH511_RS27195 | Protein ID | WP_001312851.1 |
| Coordinates | 59957..60106 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 59853..59912 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH511_RS27155 (55513) | 55513..55578 | - | 66 | Protein_75 | helix-turn-helix domain-containing protein | - |
| OH511_RS27160 (55631) | 55631..56335 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH511_RS27165 (56360) | 56360..56560 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OH511_RS27170 (56580) | 56580..57326 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH511_RS27175 (57381) | 57381..57941 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH511_RS27180 (58073) | 58073..58273 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OH511_RS27185 (58659) | 58659..59258 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH511_RS27190 (59320) | 59320..59652 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (59853) | 59853..59912 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (59853) | 59853..59912 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (59853) | 59853..59912 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (59853) | 59853..59912 | - | 60 | NuclAT_1 | - | Antitoxin |
| OH511_RS27195 (59957) | 59957..60106 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OH511_RS27200 (60390) | 60390..60638 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH511_RS27205 (60883) | 60883..60957 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH511_RS27210 (60950) | 60950..61807 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH511_RS27215 (62746) | 62746..63399 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH511_RS27220 (63492) | 63492..63749 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH511_RS27225 (63682) | 63682..64083 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH511_RS27230 (64332) | 64332..64747 | + | 416 | Protein_90 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..121138 | 121138 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260933 WP_001312851.1 NZ_CP107364:59957-60106 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260933 NZ_CP107364:c59912-59853 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
