Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2605226..2605888 | Replicon | chromosome |
Accession | NZ_CP107262 | ||
Organism | Leclercia adecarboxylata strain 2022CK-00320 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N5937_RS13040 | Protein ID | WP_263950106.1 |
Coordinates | 2605226..2605624 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N5937_RS13045 | Protein ID | WP_156653662.1 |
Coordinates | 2605628..2605888 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5937_RS13020 (2601225) | 2601225..2602313 | + | 1089 | WP_159340366.1 | AAA family ATPase | - |
N5937_RS13025 (2602333) | 2602333..2603295 | - | 963 | WP_263950104.1 | helix-turn-helix domain-containing protein | - |
N5937_RS13030 (2603321) | 2603321..2604100 | - | 780 | WP_214421461.1 | MBL fold metallo-hydrolase | - |
N5937_RS13035 (2604228) | 2604228..2605031 | - | 804 | WP_263950105.1 | lipoprotein NlpA | - |
N5937_RS13040 (2605226) | 2605226..2605624 | - | 399 | WP_263950106.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5937_RS13045 (2605628) | 2605628..2605888 | - | 261 | WP_156653662.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N5937_RS13050 (2606006) | 2606006..2607505 | - | 1500 | WP_156653661.1 | MDR family MFS transporter | - |
N5937_RS13055 (2607584) | 2607584..2608243 | + | 660 | WP_156653660.1 | TetR/AcrR family transcriptional regulator | - |
N5937_RS13060 (2608240) | 2608240..2608659 | - | 420 | WP_263950107.1 | GNAT family N-acetyltransferase | - |
N5937_RS13065 (2608982) | 2608982..2609278 | + | 297 | WP_103177671.1 | YicS family protein | - |
N5937_RS13070 (2609315) | 2609315..2610262 | - | 948 | WP_103177670.1 | LacI family DNA-binding transcriptional regulator | - |
N5937_RS13075 (2610557) | 2610557..2610871 | + | 315 | WP_103177669.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2594105..2605888 | 11783 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14654.78 Da Isoelectric Point: 5.5081
>T260576 WP_263950106.1 NZ_CP107262:c2605624-2605226 [Leclercia adecarboxylata]
MLHMLDTNIVSHLVRQHPGVVNHYSRLAPEDMCISSVAEAELLYGVAKKQSLRLHETISEFLKTITVCDWDSDAAAIYGK
LRAEMEKRGKVMGDLDQLIAAHAISRGTTIVTNDQAFAMVQELTVEDWTTAA
MLHMLDTNIVSHLVRQHPGVVNHYSRLAPEDMCISSVAEAELLYGVAKKQSLRLHETISEFLKTITVCDWDSDAAAIYGK
LRAEMEKRGKVMGDLDQLIAAHAISRGTTIVTNDQAFAMVQELTVEDWTTAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|