Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 894012..894669 | Replicon | chromosome |
| Accession | NZ_CP107040 | ||
| Organism | Klebsiella oxytoca strain TYL-T1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A181X6I0 |
| Locus tag | NQA44_RS04330 | Protein ID | WP_004105559.1 |
| Coordinates | 894259..894669 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A285B945 |
| Locus tag | NQA44_RS04325 | Protein ID | WP_004105561.1 |
| Coordinates | 894012..894278 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQA44_RS04310 (NQA44_04310) | 889265..889690 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
| NQA44_RS04315 (NQA44_04315) | 889811..892609 | - | 2799 | WP_023321613.1 | transcriptional regulator DagR | - |
| NQA44_RS04320 (NQA44_04320) | 892785..893768 | - | 984 | WP_004115279.1 | tRNA-modifying protein YgfZ | - |
| NQA44_RS04325 (NQA44_04325) | 894012..894278 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
| NQA44_RS04330 (NQA44_04330) | 894259..894669 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
| NQA44_RS04335 (NQA44_04335) | 894678..895199 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
| NQA44_RS04340 (NQA44_04340) | 895321..896217 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| NQA44_RS04345 (NQA44_04345) | 896240..896953 | + | 714 | WP_023321612.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NQA44_RS04350 (NQA44_04350) | 896959..898692 | + | 1734 | WP_004105553.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T260468 WP_004105559.1 NZ_CP107040:894259-894669 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A181X6I0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285B945 |