Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 2709606..2710131 | Replicon | chromosome |
Accession | NZ_CP107020 | ||
Organism | Brachybacterium huguangmaarense strain BRM-3 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | BRM3_RS12470 | Protein ID | WP_263595464.1 |
Coordinates | 2709606..2709863 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | BRM3_RS12475 | Protein ID | WP_263593623.1 |
Coordinates | 2709865..2710131 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BRM3_RS12455 (BRM3_12455) | 2705183..2708071 | - | 2889 | WP_263593620.1 | excinuclease ABC subunit UvrA | - |
BRM3_RS12460 (BRM3_12460) | 2708193..2708966 | + | 774 | WP_263593621.1 | MBL fold metallo-hydrolase | - |
BRM3_RS12465 (BRM3_12465) | 2709144..2709575 | + | 432 | WP_263593622.1 | VOC family protein | - |
BRM3_RS12470 (BRM3_12470) | 2709606..2709863 | - | 258 | WP_263595464.1 | Txe/YoeB family addiction module toxin | Toxin |
BRM3_RS12475 (BRM3_12475) | 2709865..2710131 | - | 267 | WP_263593623.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
BRM3_RS12480 (BRM3_12480) | 2710250..2711989 | + | 1740 | WP_263593624.1 | bifunctional 3'-5' exonuclease/DNA polymerase | - |
BRM3_RS12485 (BRM3_12485) | 2712046..2712621 | + | 576 | WP_263593625.1 | dienelactone hydrolase family protein | - |
BRM3_RS12490 (BRM3_12490) | 2712671..2714779 | - | 2109 | WP_263593626.1 | excinuclease ABC subunit UvrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10232.50 Da Isoelectric Point: 8.8926
>T260449 WP_263595464.1 NZ_CP107020:c2709863-2709606 [Brachybacterium huguangmaarense]
VLLVWSSSAWDDYLWWQSQDRKTLRRINTLIQDISRNGHDGIGKPEALKHDFAGYWSRRITDEHRLVYKIEGDEVRIAAC
RYHYR
VLLVWSSSAWDDYLWWQSQDRKTLRRINTLIQDISRNGHDGIGKPEALKHDFAGYWSRRITDEHRLVYKIEGDEVRIAAC
RYHYR
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|