Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 923371..923877 | Replicon | chromosome |
Accession | NZ_CP107020 | ||
Organism | Brachybacterium huguangmaarense strain BRM-3 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | BRM3_RS04000 | Protein ID | WP_263594814.1 |
Coordinates | 923371..923625 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | BRM3_RS04005 | Protein ID | WP_263594815.1 |
Coordinates | 923626..923877 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BRM3_RS03980 (BRM3_03980) | 919540..920493 | + | 954 | WP_263594810.1 | sugar ABC transporter permease | - |
BRM3_RS03985 (BRM3_03985) | 920503..921432 | + | 930 | WP_263594811.1 | carbohydrate ABC transporter permease | - |
BRM3_RS03990 (BRM3_03990) | 921429..922430 | + | 1002 | WP_263594812.1 | LacI family DNA-binding transcriptional regulator | - |
BRM3_RS03995 (BRM3_03995) | 922462..923301 | + | 840 | WP_263594813.1 | MBL fold metallo-hydrolase | - |
BRM3_RS04000 (BRM3_04000) | 923371..923625 | - | 255 | WP_263594814.1 | Txe/YoeB family addiction module toxin | Toxin |
BRM3_RS04005 (BRM3_04005) | 923626..923877 | - | 252 | WP_263594815.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
BRM3_RS04010 (BRM3_04010) | 923989..925908 | + | 1920 | WP_263594816.1 | DNA helicase RecQ | - |
BRM3_RS04015 (BRM3_04015) | 926148..926699 | + | 552 | WP_263594817.1 | universal stress protein | - |
BRM3_RS04020 (BRM3_04020) | 926696..927178 | + | 483 | WP_263594818.1 | CrcB family protein | - |
BRM3_RS04025 (BRM3_04025) | 927178..927552 | + | 375 | WP_263594819.1 | CrcB family protein | - |
BRM3_RS04030 (BRM3_04030) | 927603..927857 | - | 255 | WP_263594820.1 | hypothetical protein | - |
BRM3_RS04035 (BRM3_04035) | 928073..928789 | + | 717 | WP_263595388.1 | ethanolamine ammonia-lyase subunit EutC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9885.20 Da Isoelectric Point: 7.2747
>T260448 WP_263594814.1 NZ_CP107020:c923625-923371 [Brachybacterium huguangmaarense]
VRLVWDRSAWEDYTSWQTSDRKILKRINTLLDACLREPTTGLGKPEPLKYGAQGAWSRRITEEHHLVYLVDGDDLVILQA
RYHY
VRLVWDRSAWEDYTSWQTSDRKILKRINTLLDACLREPTTGLGKPEPLKYGAQGAWSRRITEEHHLVYLVDGDDLVILQA
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|