Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4498384..4499138 | Replicon | chromosome |
| Accession | NZ_CP107010 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | OF884_RS21660 | Protein ID | WP_000558163.1 |
| Coordinates | 4498384..4498695 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OF884_RS21665 | Protein ID | WP_001259009.1 |
| Coordinates | 4498692..4499138 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF884_RS21630 (4494050) | 4494050..4494952 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| OF884_RS21635 (4494949) | 4494949..4495584 | + | 636 | WP_000829022.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OF884_RS21640 (4495581) | 4495581..4496510 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OF884_RS21645 (4496548) | 4496548..4496922 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| OF884_RS21650 (4496922) | 4496922..4497164 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| OF884_RS21655 (4497369) | 4497369..4498298 | + | 930 | WP_001162860.1 | alpha/beta hydrolase | - |
| OF884_RS21660 (4498384) | 4498384..4498695 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OF884_RS21665 (4498692) | 4498692..4499138 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OF884_RS21670 (4499153) | 4499153..4500094 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OF884_RS21675 (4500139) | 4500139..4500576 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| OF884_RS21680 (4500573) | 4500573..4501445 | - | 873 | WP_000921424.1 | virulence factor BrkB family protein | - |
| OF884_RS21685 (4501439) | 4501439..4502038 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OF884_RS21690 (4502229) | 4502229..4503032 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OF884_RS21695 (4503066) | 4503066..4503962 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T260413 WP_000558163.1 NZ_CP107010:4498384-4498695 [Salmonella enterica subsp. enterica serovar Paratyphi B]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT260413 WP_001259009.1 NZ_CP107010:4498692-4499138 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|