Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4496548..4497164 Replicon chromosome
Accession NZ_CP107010
Organism Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag OF884_RS21645 Protein ID WP_000238494.1
Coordinates 4496548..4496922 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag OF884_RS21650 Protein ID WP_001523745.1
Coordinates 4496922..4497164 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF884_RS21630 (4494050) 4494050..4494952 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
OF884_RS21635 (4494949) 4494949..4495584 + 636 WP_000829022.1 formate dehydrogenase cytochrome b556 subunit -
OF884_RS21640 (4495581) 4495581..4496510 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
OF884_RS21645 (4496548) 4496548..4496922 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
OF884_RS21650 (4496922) 4496922..4497164 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
OF884_RS21655 (4497369) 4497369..4498298 + 930 WP_001162860.1 alpha/beta hydrolase -
OF884_RS21660 (4498384) 4498384..4498695 + 312 WP_000558163.1 type II toxin-antitoxin system HigB family toxin -
OF884_RS21665 (4498692) 4498692..4499138 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
OF884_RS21670 (4499153) 4499153..4500094 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
OF884_RS21675 (4500139) 4500139..4500576 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
OF884_RS21680 (4500573) 4500573..4501445 - 873 WP_000921424.1 virulence factor BrkB family protein -
OF884_RS21685 (4501439) 4501439..4502038 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T260412 WP_000238494.1 NZ_CP107010:c4496922-4496548 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT260412 WP_001523745.1 NZ_CP107010:c4497164-4496922 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References