Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2966991..2967648 | Replicon | chromosome |
Accession | NZ_CP106838 | ||
Organism | Klebsiella michiganensis strain K5-3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | J5U333 |
Locus tag | N6B35_RS14105 | Protein ID | WP_004854060.1 |
Coordinates | 2967238..2967648 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | H3N295 |
Locus tag | N6B35_RS14100 | Protein ID | WP_004124953.1 |
Coordinates | 2966991..2967257 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6B35_RS14085 (N6B35_14085) | 2962225..2962650 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
N6B35_RS14090 (N6B35_14090) | 2962771..2965569 | - | 2799 | WP_014226794.1 | transcriptional regulator DagR | - |
N6B35_RS14095 (N6B35_14095) | 2965763..2966746 | - | 984 | WP_014226793.1 | tRNA-modifying protein YgfZ | - |
N6B35_RS14100 (N6B35_14100) | 2966991..2967257 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
N6B35_RS14105 (N6B35_14105) | 2967238..2967648 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
N6B35_RS14110 (N6B35_14110) | 2967657..2968178 | - | 522 | WP_014226792.1 | flavodoxin FldB | - |
N6B35_RS14115 (N6B35_14115) | 2968300..2969196 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
N6B35_RS14120 (N6B35_14120) | 2969219..2969932 | + | 714 | WP_004854054.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N6B35_RS14125 (N6B35_14125) | 2969938..2971671 | + | 1734 | WP_032751182.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T259882 WP_004854060.1 NZ_CP106838:2967238-2967648 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYA5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H3L9 |