Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 656926..657581 | Replicon | chromosome |
| Accession | NZ_CP106815 | ||
| Organism | Neisseria gonorrhoeae strain 10562 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OCL41_RS03530 | Protein ID | WP_229931500.1 |
| Coordinates | 657162..657581 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | OCL41_RS03525 | Protein ID | WP_003688410.1 |
| Coordinates | 656926..657162 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCL41_RS03495 (OCL41_03495) | 652061..652348 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| OCL41_RS03500 (OCL41_03500) | 652420..653586 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| OCL41_RS03505 (OCL41_03505) | 653597..654487 | + | 891 | WP_229931474.1 | succinate--CoA ligase subunit alpha | - |
| OCL41_RS03510 (OCL41_03510) | 654870..655256 | - | 387 | Protein_685 | transposase | - |
| OCL41_RS03515 (OCL41_03515) | 655495..655896 | + | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
| OCL41_RS03520 (OCL41_03520) | 655901..656479 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
| OCL41_RS03525 (OCL41_03525) | 656926..657162 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| OCL41_RS03530 (OCL41_03530) | 657162..657581 | + | 420 | WP_229931500.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| OCL41_RS03535 (OCL41_03535) | 657730..659184 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| OCL41_RS03540 (OCL41_03540) | 659181..659882 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| OCL41_RS03545 (OCL41_03545) | 659879..660658 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| OCL41_RS03550 (OCL41_03550) | 660806..662347 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15336.67 Da Isoelectric Point: 5.5742
>T259852 WP_229931500.1 NZ_CP106815:657162-657581 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|