Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 646121..646916 | Replicon | chromosome |
| Accession | NZ_CP106756 | ||
| Organism | Escherichia coli strain B-JRPT-4119 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A658LKE6 |
| Locus tag | N8153_RS02980 | Protein ID | WP_001596171.1 |
| Coordinates | 646121..646495 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6D0GHH4 |
| Locus tag | N8153_RS02985 | Protein ID | WP_071342845.1 |
| Coordinates | 646542..646916 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8153_RS02960 (642210) | 642210..643748 | - | 1539 | WP_001187177.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| N8153_RS02965 (644497) | 644497..645339 | - | 843 | Protein_564 | DUF4942 domain-containing protein | - |
| N8153_RS02970 (645424) | 645424..645621 | - | 198 | WP_001596173.1 | DUF957 domain-containing protein | - |
| N8153_RS02975 (645633) | 645633..646124 | - | 492 | WP_001596172.1 | DUF5983 family protein | - |
| N8153_RS02980 (646121) | 646121..646495 | - | 375 | WP_001596171.1 | TA system toxin CbtA family protein | Toxin |
| N8153_RS02985 (646542) | 646542..646916 | - | 375 | WP_071342845.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N8153_RS02990 (647079) | 647079..647300 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| N8153_RS02995 (647363) | 647363..647839 | - | 477 | WP_001186726.1 | RadC family protein | - |
| N8153_RS03000 (647855) | 647855..648340 | - | 486 | WP_001596167.1 | antirestriction protein | - |
| N8153_RS03005 (648432) | 648432..648914 | - | 483 | Protein_572 | DUF945 domain-containing protein | - |
| N8153_RS03010 (649038) | 649038..649271 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
| N8153_RS03015 (649342) | 649342..649572 | - | 231 | Protein_574 | autotransporter adhesin family protein | - |
| N8153_RS03020 (649570) | 649570..649875 | + | 306 | Protein_575 | aldolase/citrate lyase family protein | - |
| N8153_RS03025 (649886) | 649886..651418 | + | 1533 | WP_000192239.1 | citrate lyase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 634721..649884 | 15163 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14161.14 Da Isoelectric Point: 6.7041
>T259709 WP_001596171.1 NZ_CP106756:c646495-646121 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYELVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPDTHVREASRCPSPVTIWQTLLARLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYELVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13744.51 Da Isoelectric Point: 6.4757
>AT259709 WP_071342845.1 NZ_CP106756:c646916-646542 [Escherichia coli]
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLTVYPTPAPATTS
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLTVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A658LKE6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6D0GHH4 |