Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2763733..2764411 | Replicon | chromosome |
| Accession | NZ_CP104920 | ||
| Organism | Dickeya solani strain RNS 05.1.2A | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | RS71_RS12560 | Protein ID | WP_057084793.1 |
| Coordinates | 2763980..2764411 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | RS71_RS12555 | Protein ID | WP_013316361.1 |
| Coordinates | 2763733..2763999 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RS71_RS12535 | 2760187..2760837 | + | 651 | WP_057084789.1 | LysE family translocator | - |
| RS71_RS12540 | 2760911..2761519 | - | 609 | WP_057084790.1 | HD domain-containing protein | - |
| RS71_RS12545 | 2761730..2762380 | + | 651 | WP_057084791.1 | hemolysin III family protein | - |
| RS71_RS12550 | 2762453..2763433 | - | 981 | WP_057084792.1 | tRNA-modifying protein YgfZ | - |
| RS71_RS12555 | 2763733..2763999 | + | 267 | WP_013316361.1 | FAD assembly factor SdhE | Antitoxin |
| RS71_RS12560 | 2763980..2764411 | + | 432 | WP_057084793.1 | protein YgfX | Toxin |
| RS71_RS12565 | 2764502..2765020 | - | 519 | WP_057084794.1 | flavodoxin FldB | - |
| RS71_RS12570 | 2765149..2766474 | - | 1326 | WP_057084795.1 | MFS transporter | - |
| RS71_RS12575 | 2766822..2767721 | + | 900 | WP_057084796.1 | site-specific tyrosine recombinase XerD | - |
| RS71_RS12580 | 2767810..2768526 | + | 717 | WP_057084797.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 16821.51 Da Isoelectric Point: 11.7737
>T259496 WP_057084793.1 NZ_CP104920:2763980-2764411 [Dickeya solani]
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATNGKGHQRLWLASDSMGNEEWRLLRQLLQQHPLQGTESSRHH
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATNGKGHQRLWLASDSMGNEEWRLLRQLLQQHPLQGTESSRHH
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|