Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 54914..55572 | Replicon | plasmid punamed1 |
| Accession | NZ_CP104787 | ||
| Organism | Acinetobacter baumannii strain Ab-3556 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N7E56_RS19245 | Protein ID | WP_000312250.1 |
| Coordinates | 54914..55273 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7E56_RS19250 | Protein ID | WP_001096429.1 |
| Coordinates | 55273..55572 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E56_RS19215 | 50420..50734 | - | 315 | WP_000708714.1 | hypothetical protein | - |
| N7E56_RS19220 | 51804..52562 | - | 759 | WP_001053129.1 | hypothetical protein | - |
| N7E56_RS19225 | 52629..53012 | - | 384 | WP_000654349.1 | hypothetical protein | - |
| N7E56_RS19230 | 53151..53849 | - | 699 | WP_000873190.1 | hypothetical protein | - |
| N7E56_RS19235 | 53916..54098 | - | 183 | WP_000373385.1 | hypothetical protein | - |
| N7E56_RS19240 | 54147..54713 | - | 567 | WP_041171756.1 | hypothetical protein | - |
| N7E56_RS19245 | 54914..55273 | + | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7E56_RS19250 | 55273..55572 | + | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| N7E56_RS19255 | 55673..55936 | + | 264 | WP_000110863.1 | hypothetical protein | - |
| N7E56_RS19260 | 56029..56511 | - | 483 | WP_001052677.1 | hypothetical protein | - |
| N7E56_RS19265 | 57134..57670 | - | 537 | WP_000731981.1 | hypothetical protein | - |
| N7E56_RS19270 | 57720..58274 | - | 555 | WP_000790085.1 | hypothetical protein | - |
| N7E56_RS19275 | 58355..58864 | - | 510 | WP_001043199.1 | hypothetical protein | - |
| N7E56_RS19280 | 58904..59533 | - | 630 | WP_002081923.1 | hypothetical protein | - |
| N7E56_RS19285 | 59550..59729 | - | 180 | WP_002081921.1 | hypothetical protein | - |
| N7E56_RS19290 | 59705..60277 | - | 573 | WP_000429351.1 | hypothetical protein | - |
| N7E56_RS19295 | 60282..60539 | - | 258 | WP_000834292.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..71276 | 71276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T259156 WP_000312250.1 NZ_CP104787:54914-55273 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|