Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2282013..2282752 | Replicon | chromosome |
| Accession | NZ_CP104689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00376 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
| Locus tag | N5929_RS10925 | Protein ID | WP_003857133.1 |
| Coordinates | 2282013..2282498 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | N5929_RS10930 | Protein ID | WP_003857131.1 |
| Coordinates | 2282486..2282752 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5929_RS10905 (N5929_02885) | 2278166..2278924 | - | 759 | WP_261666235.1 | trans-aconitate 2-methyltransferase | - |
| N5929_RS10910 (N5929_02880) | 2279009..2279593 | - | 585 | WP_017382349.1 | GDP-mannose pyrophosphatase nudK | - |
| N5929_RS10915 (N5929_02875) | 2279680..2280438 | + | 759 | WP_261666234.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N5929_RS10920 (N5929_02870) | 2280543..2281835 | + | 1293 | WP_261666233.1 | glycosyl hydrolase family 28 protein | - |
| N5929_RS10925 (N5929_02865) | 2282013..2282498 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
| N5929_RS10930 (N5929_02860) | 2282486..2282752 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| N5929_RS10935 (N5929_02855) | 2282816..2283745 | - | 930 | WP_261666232.1 | LysR family transcriptional regulator | - |
| N5929_RS10940 (N5929_02850) | 2283875..2285257 | + | 1383 | WP_261666231.1 | MFS transporter | - |
| N5929_RS10945 (N5929_02845) | 2285280..2286275 | - | 996 | WP_015570513.1 | DUF2891 domain-containing protein | - |
| N5929_RS10950 (N5929_02840) | 2286285..2287271 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2268109..2282752 | 14643 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T259005 WP_003857133.1 NZ_CP104689:c2282498-2282013 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9PBP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |