Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3884460..3885247 Replicon chromosome
Accession NZ_CP104681
Organism Escherichia coli strain 2022CK-00450

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag N5922_RS19205 Protein ID WP_060615264.1
Coordinates 3884870..3885247 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2H9G3E7
Locus tag N5922_RS19200 Protein ID WP_000066236.1
Coordinates 3884460..3884819 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5922_RS19160 (3880148) 3880148..3880783 + 636 WP_000772020.1 hypothetical protein -
N5922_RS19165 (3880819) 3880819..3881271 + 453 WP_060615267.1 hypothetical protein -
N5922_RS19170 (3881268) 3881268..3881717 + 450 WP_060615266.1 IrmA family protein -
N5922_RS19175 (3881794) 3881794..3882027 + 234 WP_001114682.1 DUF905 domain-containing protein -
N5922_RS19180 (3882147) 3882147..3882965 + 819 WP_001234406.1 DUF932 domain-containing protein -
N5922_RS19185 (3883233) 3883233..3883703 + 471 WP_060615265.1 antirestriction protein -
N5922_RS19190 (3883715) 3883715..3884194 + 480 WP_000437750.1 DNA repair protein RadC -
N5922_RS19195 (3884215) 3884215..3884436 + 222 WP_000691981.1 DUF987 domain-containing protein -
N5922_RS19200 (3884460) 3884460..3884819 + 360 WP_000066236.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5922_RS19205 (3884870) 3884870..3885247 + 378 WP_060615264.1 TA system toxin CbtA family protein Toxin
N5922_RS19210 (3885244) 3885244..3885735 + 492 WP_060615263.1 DUF5983 family protein -
N5922_RS19215 (3885767) 3885767..3885970 + 204 WP_060615262.1 DUF957 domain-containing protein -
N5922_RS19220 (3886051) 3886051..3886902 + 852 WP_060615261.1 DUF4942 domain-containing protein -
N5922_RS19230 (3887233) 3887233..3887964 - 732 WP_001300756.1 DNA polymerase III subunit epsilon -
N5922_RS19235 (3888029) 3888029..3888496 + 468 WP_000917883.1 ribonuclease HI -
N5922_RS19240 (3888493) 3888493..3889215 - 723 WP_001295200.1 class I SAM-dependent methyltransferase -
N5922_RS19245 (3889249) 3889249..3890004 + 756 WP_001052721.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14101.83 Da        Isoelectric Point: 7.3573

>T258997 WP_060615264.1 NZ_CP104681:3884870-3885247 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLSSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13127.02 Da        Isoelectric Point: 7.0261

>AT258997 WP_000066236.1 NZ_CP104681:3884460-3884819 [Escherichia coli]
MSNKIPTVNHDITEPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2H9G3E7

References