Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 993538..994192 | Replicon | chromosome |
| Accession | NZ_CP104681 | ||
| Organism | Escherichia coli strain 2022CK-00450 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | N5922_RS04930 | Protein ID | WP_000244777.1 |
| Coordinates | 993785..994192 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5922_RS04925 | Protein ID | WP_000354046.1 |
| Coordinates | 993538..993804 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5922_RS04900 (988707) | 988707..989450 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| N5922_RS04905 (989507) | 989507..990940 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| N5922_RS04910 (990985) | 990985..991296 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5922_RS04915 (991460) | 991460..992119 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N5922_RS04920 (992315) | 992315..993295 | - | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
| N5922_RS04925 (993538) | 993538..993804 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5922_RS04930 (993785) | 993785..994192 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| N5922_RS04935 (994232) | 994232..994753 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5922_RS04940 (994865) | 994865..995761 | + | 897 | WP_000806628.1 | site-specific tyrosine recombinase XerD | - |
| N5922_RS04945 (995786) | 995786..996496 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5922_RS04950 (996502) | 996502..998235 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T258983 WP_000244777.1 NZ_CP104681:993785-994192 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |