Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeV-yafW/CbtA-CbeA
Location 842880..843673 Replicon chromosome
Accession NZ_CP104681
Organism Escherichia coli strain 2022CK-00450

Toxin (Protein)


Gene name yeeV Uniprot ID S1EZ92
Locus tag N5922_RS04190 Protein ID WP_000854726.1
Coordinates 842880..843257 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EBQ7
Locus tag N5922_RS04195 Protein ID WP_001548930.1
Coordinates 843347..843673 (-) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5922_RS04160 (838288) 838288..839265 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
N5922_RS04165 (839262) 839262..840440 + 1179 WP_000094962.1 type II secretion system protein GspL -
N5922_RS04170 (840442) 840442..840978 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
N5922_RS04175 (841259) 841259..842101 - 843 WP_001547770.1 DUF4942 domain-containing protein -
N5922_RS04180 (842186) 842186..842383 - 198 WP_000839269.1 DUF957 domain-containing protein -
N5922_RS04185 (842395) 842395..842883 - 489 WP_001547769.1 DUF5983 family protein -
N5922_RS04190 (842880) 842880..843257 - 378 WP_000854726.1 TA system toxin CbtA family protein Toxin
N5922_RS04195 (843347) 843347..843673 - 327 WP_001548930.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
N5922_RS04200 (843692) 843692..843913 - 222 WP_000691994.1 DUF987 domain-containing protein -
N5922_RS04205 (843922) 843922..844398 - 477 WP_000811693.1 RadC family protein -
N5922_RS04210 (844417) 844417..844875 - 459 WP_001548150.1 antirestriction protein -
N5922_RS04215 (844973) 844973..845212 - 240 WP_000194654.1 DUF905 family protein -
N5922_RS04220 (845289) 845289..845756 - 468 WP_001385283.1 protein YkfB -
N5922_RS04225 (845779) 845779..846222 - 444 WP_001547764.1 lipoprotein YafY -
N5922_RS04230 (846222) 846222..846458 - 237 WP_057107659.1 protein YpjK -
N5922_RS04235 (846499) 846499..847200 - 702 WP_023326104.1 WYL domain-containing protein -
N5922_RS04240 (847417) 847417..848238 - 822 WP_000197389.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-103)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14164.10 Da        Isoelectric Point: 7.8045

>T258982 WP_000854726.1 NZ_CP104681:c843257-842880 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 12301.97 Da        Isoelectric Point: 7.0273

>AT258982 WP_001548930.1 NZ_CP104681:c843673-843347 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTFGSCGYVYLAVYPTPETKK

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ92

Antitoxin

Source ID Structure
AlphaFold DB S1EBQ7

References