Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2825333..2826132 | Replicon | chromosome |
| Accession | NZ_CP104649 | ||
| Organism | Escherichia coli strain PNUSAE008512 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | N5913_RS14875 | Protein ID | WP_000347273.1 |
| Coordinates | 2825668..2826132 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | C3ST72 |
| Locus tag | N5913_RS14870 | Protein ID | WP_001302819.1 |
| Coordinates | 2825333..2825668 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5913_RS14855 (2821118) | 2821118..2821888 | - | 771 | WP_001058231.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| N5913_RS14860 (2821904) | 2821904..2823238 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N5913_RS14865 (2823613) | 2823613..2825184 | + | 1572 | WP_001273776.1 | galactarate dehydratase | - |
| N5913_RS14870 (2825333) | 2825333..2825668 | + | 336 | WP_001302819.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N5913_RS14875 (2825668) | 2825668..2826132 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N5913_RS14880 (2826187) | 2826187..2826996 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N5913_RS14885 (2827245) | 2827245..2828525 | + | 1281 | WP_000681927.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N5913_RS14890 (2828548) | 2828548..2829021 | + | 474 | WP_001301475.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N5913_RS14895 (2829032) | 2829032..2829811 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N5913_RS14900 (2829801) | 2829801..2830679 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N5913_RS14905 (2830697) | 2830697..2831131 | + | 435 | WP_000948831.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T258856 WP_000347273.1 NZ_CP104649:2825668-2826132 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|