Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3938611..3939316 | Replicon | chromosome |
Accession | NZ_CP104645 | ||
Organism | Escherichia coli strain PNUSAE019785 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q8X3N0 |
Locus tag | N5932_RS19210 | Protein ID | WP_000539519.1 |
Coordinates | 3938930..3939316 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5932_RS19205 | Protein ID | WP_001280945.1 |
Coordinates | 3938611..3938940 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5932_RS19190 (3933768) | 3933768..3934679 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
N5932_RS19195 (3934857) | 3934857..3937205 | + | 2349 | WP_000950320.1 | EAL domain-containing protein | - |
N5932_RS19200 (3937213) | 3937213..3938541 | + | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
N5932_RS19205 (3938611) | 3938611..3938940 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N5932_RS19210 (3938930) | 3938930..3939316 | - | 387 | WP_000539519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5932_RS19215 (3939542) | 3939542..3940867 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N5932_RS19220 (3941080) | 3941080..3941463 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N5932_RS19225 (3941574) | 3941574..3942689 | + | 1116 | WP_000554959.1 | aldose sugar dehydrogenase YliI | - |
N5932_RS19230 (3942686) | 3942686..3943312 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14279.42 Da Isoelectric Point: 9.9296
>T258798 WP_000539519.1 NZ_CP104645:c3939316-3938930 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|