Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2789504..2789729 | Replicon | chromosome |
| Accession | NZ_CP104643 | ||
| Organism | Salmonella enterica strain 1020677 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | N5930_RS13515 | Protein ID | WP_000813254.1 |
| Coordinates | 2789504..2789659 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2789671..2789729 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5930_RS13480 | 2784611..2784892 | - | 282 | WP_000445513.1 | phage holin family protein | - |
| N5930_RS13485 | 2784882..2785070 | - | 189 | WP_001688615.1 | putative holin | - |
| N5930_RS13490 | 2785064..2785387 | - | 324 | Protein_2621 | tellurite/colicin resistance protein | - |
| N5930_RS13495 | 2787558..2788094 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
| N5930_RS13500 | 2788091..2788381 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
| N5930_RS13505 | 2788381..2788980 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
| N5930_RS13510 | 2789043..2789213 | - | 171 | WP_000734094.1 | hypothetical protein | - |
| N5930_RS13515 | 2789504..2789659 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2789671..2789729 | + | 59 | - | - | Antitoxin |
| N5930_RS13520 | 2790086..2791018 | + | 933 | WP_000556389.1 | hypothetical protein | - |
| N5930_RS13525 | 2791015..2791569 | + | 555 | WP_001033796.1 | hypothetical protein | - |
| N5930_RS13530 | 2791731..2792060 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
| N5930_RS13535 | 2792104..2792151 | - | 48 | Protein_2630 | hypothetical protein | - |
| N5930_RS13540 | 2792333..2792800 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
| N5930_RS13545 | 2793185..2793340 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
| N5930_RS13550 | 2793448..2793969 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
| N5930_RS13555 | 2794407..2794628 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2784069..2795940 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T258767 WP_000813254.1 NZ_CP104643:c2789659-2789504 [Salmonella enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT258767 NZ_CP104643:2789671-2789729 [Salmonella enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|