Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2437557..2437782 | Replicon | chromosome |
Accession | NZ_CP104641 | ||
Organism | Salmonella enterica strain 1019942 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | N5927_RS11830 | Protein ID | WP_000813254.1 |
Coordinates | 2437557..2437712 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2437724..2437782 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5927_RS11795 | 2432664..2432945 | - | 282 | WP_000445513.1 | phage holin family protein | - |
N5927_RS11800 | 2432935..2433123 | - | 189 | WP_001688615.1 | putative holin | - |
N5927_RS11805 | 2433117..2433440 | - | 324 | Protein_2311 | tellurite/colicin resistance protein | - |
N5927_RS11810 | 2435611..2436147 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
N5927_RS11815 | 2436144..2436434 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
N5927_RS11820 | 2436434..2437033 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
N5927_RS11825 | 2437096..2437266 | - | 171 | WP_000734094.1 | hypothetical protein | - |
N5927_RS11830 | 2437557..2437712 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2437724..2437782 | + | 59 | - | - | Antitoxin |
N5927_RS11835 | 2438139..2439071 | + | 933 | WP_000556389.1 | hypothetical protein | - |
N5927_RS11840 | 2439068..2439622 | + | 555 | WP_001033796.1 | hypothetical protein | - |
N5927_RS11845 | 2439784..2440113 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
N5927_RS11850 | 2440157..2440204 | - | 48 | Protein_2320 | hypothetical protein | - |
N5927_RS11855 | 2440386..2440853 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
N5927_RS11860 | 2441238..2441393 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
N5927_RS11865 | 2441501..2442022 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
N5927_RS11870 | 2442460..2442681 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2432122..2443993 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T258744 WP_000813254.1 NZ_CP104641:c2437712-2437557 [Salmonella enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT258744 NZ_CP104641:2437724-2437782 [Salmonella enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|