Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4471819..4472479 | Replicon | chromosome |
| Accession | NZ_CP104638 | ||
| Organism | Salmonella enterica strain PNUSAS118466 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | N4311_RS22850 | Protein ID | WP_000244756.1 |
| Coordinates | 4472066..4472479 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | N4311_RS22845 | Protein ID | WP_000351186.1 |
| Coordinates | 4471819..4472085 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4311_RS22825 (4467751) | 4467751..4469184 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
| N4311_RS22830 (4469339) | 4469339..4469653 | + | 315 | WP_001182980.1 | N(4)-acetylcytidine aminohydrolase | - |
| N4311_RS22835 (4469814) | 4469814..4470473 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| N4311_RS22840 (4470589) | 4470589..4471569 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
| N4311_RS22845 (4471819) | 4471819..4472085 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| N4311_RS22850 (4472066) | 4472066..4472479 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
| N4311_RS22855 (4472532) | 4472532..4473053 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| N4311_RS22860 (4473166) | 4473166..4474062 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| N4311_RS22865 (4474086) | 4474086..4474799 | + | 714 | WP_000745621.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N4311_RS22870 (4474805) | 4474805..4476538 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T258707 WP_000244756.1 NZ_CP104638:4472066-4472479 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |