Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 14015..14540 | Replicon | plasmid pHNAH8161B-3 |
| Accession | NZ_CP104607 | ||
| Organism | Klebsiella pneumoniae strain AHM8C161BI | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | J5VBT8 |
| Locus tag | N5862_RS29985 | Protein ID | WP_004197633.1 |
| Coordinates | 14235..14540 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A9E1GDP8 |
| Locus tag | N5862_RS29980 | Protein ID | WP_004197642.1 |
| Coordinates | 14015..14233 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5862_RS29960 (N5862_29950) | 10007..10711 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| N5862_RS29965 (N5862_29955) | 10764..10997 | - | 234 | Protein_13 | BREX system Lon protease-like protein BrxL | - |
| N5862_RS29970 (N5862_29960) | 11676..12704 | - | 1029 | WP_032445668.1 | Abi family protein | - |
| N5862_RS29975 (N5862_29965) | 12865..13446 | - | 582 | WP_072310991.1 | hypothetical protein | - |
| N5862_RS29980 (N5862_29970) | 14015..14233 | + | 219 | WP_004197642.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| N5862_RS29985 (N5862_29975) | 14235..14540 | + | 306 | WP_004197633.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| N5862_RS29990 (N5862_29980) | 14709..15104 | + | 396 | WP_164530166.1 | hypothetical protein | - |
| N5862_RS29995 (N5862_29985) | 15131..15454 | + | 324 | WP_004197641.1 | hypothetical protein | - |
| N5862_RS30000 (N5862_29990) | 15451..16467 | + | 1017 | WP_164530167.1 | hypothetical protein | - |
| N5862_RS30005 (N5862_29995) | 16665..17450 | + | 786 | WP_046664219.1 | site-specific integrase | - |
| N5862_RS30010 (N5862_30000) | 17899..18654 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3'')-Ib / aph(6)-Id | - | 1..110502 | 110502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11585.27 Da Isoelectric Point: 6.4661
>T258593 WP_004197633.1 NZ_CP104607:14235-14540 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|