Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3404930..3405548 | Replicon | chromosome |
| Accession | NZ_CP104536 | ||
| Organism | Escherichia coli strain E3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N5O72_RS16540 | Protein ID | WP_001291435.1 |
| Coordinates | 3405330..3405548 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N5O72_RS16535 | Protein ID | WP_000344800.1 |
| Coordinates | 3404930..3405304 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O72_RS16525 (3400019) | 3400019..3401212 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N5O72_RS16530 (3401235) | 3401235..3404384 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| N5O72_RS16535 (3404930) | 3404930..3405304 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N5O72_RS16540 (3405330) | 3405330..3405548 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N5O72_RS16545 (3405720) | 3405720..3406271 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| N5O72_RS16550 (3406387) | 3406387..3406857 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| N5O72_RS16555 (3407021) | 3407021..3408571 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N5O72_RS16560 (3408613) | 3408613..3408966 | - | 354 | Protein_3237 | DUF1428 family protein | - |
| N5O72_RS16570 (3409345) | 3409345..3409656 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| N5O72_RS16575 (3409687) | 3409687..3410259 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258361 WP_001291435.1 NZ_CP104536:3405330-3405548 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258361 WP_000344800.1 NZ_CP104536:3404930-3405304 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |