Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
| Location | 4249825..4250237 | Replicon | chromosome |
| Accession | NZ_CP104533 | ||
| Organism | Escherichia coli strain E10 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | A0A8E0IWC4 |
| Locus tag | N5O77_RS21125 | Protein ID | WP_001513534.1 |
| Coordinates | 4249896..4250237 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4249825..4249901 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O77_RS21115 (4246437) | 4246437..4247906 | + | 1470 | WP_001387312.1 | type I restriction-modification system subunit M | - |
| N5O77_RS21120 (4247906) | 4247906..4249675 | + | 1770 | WP_001513535.1 | restriction endonuclease subunit S | - |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4249825) | 4249825..4249901 | - | 77 | NuclAT_7 | - | Antitoxin |
| N5O77_RS21125 (4249896) | 4249896..4250237 | + | 342 | WP_001513534.1 | endoribonuclease SymE | Toxin |
| N5O77_RS21130 (4250284) | 4250284..4251447 | - | 1164 | WP_224153787.1 | DUF1524 domain-containing protein | - |
| N5O77_RS21135 (4251501) | 4251501..4252377 | - | 877 | Protein_4139 | DUF262 domain-containing protein | - |
| N5O77_RS21140 (4252783) | 4252783..4253703 | - | 921 | WP_001513532.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| N5O77_RS21145 (4253888) | 4253888..4255168 | + | 1281 | WP_001338077.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4234213..4250237 | 16024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12247.03 Da Isoelectric Point: 7.8545
>T258333 WP_001513534.1 NZ_CP104533:4249896-4250237 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASHYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT258333 NZ_CP104533:c4249901-4249825 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|