Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 949726..950380 | Replicon | chromosome |
| Accession | NZ_CP104533 | ||
| Organism | Escherichia coli strain E10 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N5O77_RS04670 | Protein ID | WP_000244781.1 |
| Coordinates | 949973..950380 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5O77_RS04665 | Protein ID | WP_000354046.1 |
| Coordinates | 949726..949992 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O77_RS04645 (945814) | 945814..947247 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
| N5O77_RS04650 (947292) | 947292..947603 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5O77_RS04655 (947767) | 947767..948426 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N5O77_RS04660 (948503) | 948503..949483 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| N5O77_RS04665 (949726) | 949726..949992 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5O77_RS04670 (949973) | 949973..950380 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N5O77_RS04675 (950420) | 950420..950941 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5O77_RS04680 (951053) | 951053..951949 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
| N5O77_RS04685 (951974) | 951974..952684 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5O77_RS04690 (952690) | 952690..954423 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258319 WP_000244781.1 NZ_CP104533:949973-950380 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|