Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4159366..4160201 | Replicon | chromosome |
| Accession | NZ_CP104509 | ||
| Organism | Escherichia coli strain E2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | N5O74_RS21075 | Protein ID | WP_000854821.1 |
| Coordinates | 4159824..4160201 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N5O74_RS21070 | Protein ID | WP_261202994.1 |
| Coordinates | 4159366..4159734 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O74_RS21045 (4156768) | 4156768..4157001 | + | 234 | WP_001117568.1 | DUF905 family protein | - |
| N5O74_RS21050 (4157091) | 4157091..4157909 | + | 819 | WP_261202993.1 | DUF932 domain-containing protein | - |
| N5O74_RS21055 (4158001) | 4158001..4158486 | + | 486 | WP_032180519.1 | antirestriction protein | - |
| N5O74_RS21060 (4158502) | 4158502..4158978 | + | 477 | WP_001186768.1 | RadC family protein | - |
| N5O74_RS21065 (4159065) | 4159065..4159286 | + | 222 | WP_000692352.1 | DUF987 domain-containing protein | - |
| N5O74_RS21070 (4159366) | 4159366..4159734 | + | 369 | WP_261202994.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O74_RS21075 (4159824) | 4159824..4160201 | + | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| N5O74_RS21080 (4160198) | 4160198..4160395 | + | 198 | Protein_4115 | DUF5983 family protein | - |
| N5O74_RS21085 (4160423) | 4160423..4160620 | + | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| N5O74_RS21090 (4160705) | 4160705..4161547 | + | 843 | WP_111997887.1 | DUF4942 domain-containing protein | - |
| N5O74_RS21095 (4161828) | 4161828..4162364 | - | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| N5O74_RS21100 (4162408) | 4162408..4163811 | - | 1404 | Protein_4119 | inorganic phosphate transporter PitB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T258201 WP_000854821.1 NZ_CP104509:4159824-4160201 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13729.64 Da Isoelectric Point: 6.8422
>AT258201 WP_261202994.1 NZ_CP104509:4159366-4159734 [Escherichia coli]
VSDTLPRTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPRTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|